The domain within your query sequence starts at position 25 and ends at position 154; the E-value for the Glyco_hydro_56 domain shown below is 8.8e-50.
PTAPPIFTGRPFVVAWNVPTQECAPRHKVPLDLRAFDVKATPNEGFFNQNITTFYYDRLG LYPRFDAAGTSVHGGVPQNGSLCAHLPMLKESVERYIQTQEPGGLAVIDWEEWRPVWVRN WQEKDVYRQS
Glyco_hydro_56 |
---|
PFAM accession number: | PF01630 |
---|---|
Interpro abstract (IPR018155): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. Glycoside hydrolase family 56 comprises enzymes with only one known activity; hyaluronidase EC 3.2.1.35 . The venom of Apis mellifera (Honeybee) contains several biologically-active peptides and two enzymes, one of which is a hyaluronidase [ (PUBMED:7682712) ]. The amino acid sequence of bee venom hyaluronidase contains 349 amino acids, and includes four cysteines and a number of potential glycosylation sites [ (PUBMED:7682712) ]. The sequence shows a high degree of similarity to PH-20, a membrane protein of mammalian sperm involved in sperm-egg adhesion, supporting the view that hyaluronidases play a role in fertilisation [ (PUBMED:7682712) ]. PH-20 is required for sperm adhesion to the egg zona pellucida; it is located on both the sperm plasma membrane and acrosomal membrane [ (PUBMED:2269661) ]. The amino acid sequence of the mature protein contains 468 amino acids, and includes six potential N-linked glycosylation sites and twelve cysteines, eight of which are tightly clustered near the C terminus [ (PUBMED:2269661) ]. |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO function: | hyalurononglucosaminidase activity (GO:0004415) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_56