The domain within your query sequence starts at position 127 and ends at position 404; the E-value for the Glyco_hydro_85 domain shown below is 2.6e-101.
YLEDRFIQGSEVQNPYSFYHWQYIDIFVYFSHHTVTIPPVCWTNAAHRHGVCVLGTFITE WQEGGRLCEAFLAGDEPSFQAVADRLVQIAQFFRFDGWLINIENSLTPAAVRNTPLFLQY LTAQLHQQVPGGLVLWYDSVVQSGQLKWQDELNDQNRVFFDSCDGFFTNYNWREDHLQRM VAQAGERLADVYVGVDVFARSNVVGGRFDTDKSLELIRKHGFSAALFAPGWVYECLEKSD FFQNQDKFWSLLERFLPTHSICSLPFVTSFCLGLGTRR
Glyco_hydro_85 |
---|
PFAM accession number: | PF03644 |
---|---|
Interpro abstract (IPR005201): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. This group of endo-beta-N-acetylglucosaminidases belong to the glycoside hydrolase family 85 . These enzymes work on a broad spectrum of substrates. |
GO component: | cytoplasm (GO:0005737) |
GO function: | mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity (GO:0033925) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_85