The domain within your query sequence starts at position 2 and ends at position 101; the E-value for the Glyco_tranf_2_2 domain shown below is 1.2e-8.
TAINYEIIIIDDGSPDGTREVAEQLAEIYGPDRILLRPREKKLGLGTAYIHGIKHATGNY VIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGG
Glyco_tranf_2_2 |
![]() |
---|
PFAM accession number: | PF10111 |
---|---|
Interpro abstract (IPR019290): | This entry represetns a predicted glycosyltransferase domain found in a set of prokaryotic proteins that includes putative glucosyltransferases involved in bacterial capsule biosynthesis [ (PUBMED:9515923) (PUBMED:11953367) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_tranf_2_2