The domain within your query sequence starts at position 189 and ends at position 360; the E-value for the Glyco_transf_21 domain shown below is 7e-8.
QKWGGKREVMYTAFKALGNSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQI LNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLEDWYHQKF LGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTRYLRWLNQQTRWSK
Glyco_transf_21 |
---|
PFAM accession number: | PF13506 |
---|---|
Interpro abstract (IPR025993): | This is a family of ceramide beta-glucosyltransferases ( EC 2.4.1.80 ), which catalyse the transfer of glucose to ceramide, the first glycosylation step in glycosphingolipid biosynthesis [ (PUBMED:8643456) (PUBMED:10393098) ]. They belong to the glycosyl transferase family 21. |
GO function: | transferase activity, transferring glycosyl groups (GO:0016757) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_21