The domain within your query sequence starts at position 15 and ends at position 267; the E-value for the Glyco_transf_22 domain shown below is 4e-15.
LGLLVTVATIHLVICPYTKVEESFNLQATHDLLYHQLDIDKYDHHEFPGVVPRTFLGPLV IAAFSSPVVYVLSLLEVSKFYSQLIVRGVLGLGVISGLWTLQKEVRQQFGATVAVMFCWI SATQFHLMFYCTRTLPNVLALAVVLPALTAWLQRRWALFVWLSAFVIIGFRAELAMLLGI ALLLTLYQRRLTVARVLRHAIPAGLLCLGKLASLVCLLNKKSWPYKVRAMLVTGHILVNV AYTATSLYVSHFN
Glyco_transf_22 |
![]() |
---|
PFAM accession number: | PF03901 |
---|---|
Interpro abstract (IPR005599): | Members of this family are glycosylphosphatidylinositol mannosyltransferase enzymes [intenz:2.4.1.-] [ (PUBMED:9576863) (PUBMED:10954751) ]. At least some members are localised in endoplasmic reticulum and involved in glycosyl phosphatidyl inositol (GPI) anchor biosynthesis [ (PUBMED:12200473) (PUBMED:12030331) ]. In Arabidopsis, mannosyltransferase APTG1 (Abnormal Pollen Tube Guidance1) is required for pollen tube micropylar guidance and embryo development [ (PUBMED:24963069) ]. In budding yeast, Smp3 (YOR149C) has been implemented in plasmid stability [ (PUBMED:2005867) ]. |
GO function: | transferase activity, transferring glycosyl groups (GO:0016757) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_22