The domain within your query sequence starts at position 277 and ends at position 352; the E-value for the Glyco_transf_7C domain shown below is 2.2e-10.
KMTRTDPTKPIRTPVIAGGIFVIDKSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLE IVPCSRVGHVFRKRHP
Glyco_transf_7C |
---|
PFAM accession number: | PF02709 |
---|---|
Interpro abstract (IPR027791): | This is the C-terminal domain of a family of galactosyltransferases with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases: N-acetyllactosamine synthase ( EC 2.4.1.90 ), beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase ( EC 2.4.1.38 ), and lactose synthase ( EC 2.4.1.22 ). Note that N-acetyllactosamine synthase is a component of Lactose synthase along with alpha-lactalbumin; in the absence of alpha-lactalbumin ( EC 2.4.1.90 ) is the catalysed reaction [ (PUBMED:9435216) (PUBMED:9792633) ]. Proteins containing this domain include beta-1,4-galactosyltransferases and N-acetylgalactosaminyltransferases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_7C