The domain within your query sequence starts at position 94 and ends at position 188; the E-value for the Glyco_transf_7N domain shown below is 1.1e-24.
CPDVPPGLVGRVVIEFTSPMPLERVQRENPGVLLGGRYSPPDCTPAQTVAVIIPFRHREH HLRYWLHYLHPMLRRQRLRYGVYVINQILKTSKRR
Glyco_transf_7N |
![]() |
---|
PFAM accession number: | PF13733 |
---|---|
Interpro abstract (IPR027995): | This entry represents the N-terminal domain of the galactosyltransferases with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases: N-acetyllactosamine synthase ( EC 2.4.1.90 ), beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase ( EC 2.4.1.38 ), and lactose synthase ( EC 2.4.1.22 ). Proteins containing this domain include Beta-1,4-galactosyltransferase 1-7, Beta-1,4-N-acetylgalactosaminyltransferase bre-4 and Beta-N-acetyl-D-glucosaminide beta-1,4-N-acetylglucosaminyl-transferase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_7N