The domain within your query sequence starts at position 35 and ends at position 157; the E-value for the Glycohydro_20b2 domain shown below is 7.1e-24.

LWPFPRSVQMFPRLLYISAEDFSIDHSPNSTAGPSCSLLQEAFRRYYNYVFGFYKRHHGP
ARFRAEPQLQKLLVSITLESECESFPSLSSDETYSLLVQEPVAVLKANSVWGALRGLETF
SQL

Glycohydro_20b2

Glycohydro_20b2
PFAM accession number:PF14845
Interpro abstract (IPR029019):

This entry represents the N-terminal domain of the eukaryotic beta-hexosaminidases. There are 3 forms of beta-hexosaminidase: hexosaminidase A is a trimer, with one alpha, one beta-A and one beta-B chain; hexosaminidase B is a tetramer of two beta-A and two beta-B chains; and hexosaminidase S is a homodimer of alpha chains. The two beta chains are derived from the cleavage of a precursor.

In the brain and other tissues, beta-hexosaminidase A degrades GM2 gangliosides; specifically, the enzyme hydrolyses terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides. Mutations in the beta-hexosaminidase beta-chain lead to Sandhoff disease, a lysosomal storage disorder characterised by accumulation of GM2 ganglioside [ (PUBMED:8357844) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glycohydro_20b2