The domain within your query sequence starts at position 55 and ends at position 175; the E-value for the Glyoxalase_2 domain shown below is 1.9e-11.
VAVPDLEKASSFYRDVLGAQVSEVVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPITGFL QKNKAGGMHHVCIEVDNISAAVMDLKKKKIRSLSDEAKIGAHGKPVIFLHPKDCGGVLVE L
Glyoxalase_2 |
---|
PFAM accession number: | PF12681 |
---|---|
Interpro abstract (IPR025870): | This domain is related to the glyoxalase domain ( IPR004360 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyoxalase_2