The domain within your query sequence starts at position 1 and ends at position 93; the E-value for the Guanylate_cyc_2 domain shown below is 9.2e-37.
MRHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVQVEKCTVSVQ DIQVHLAQGHVAIVLVNSGVLHCDLCSSPVKYC
Guanylate_cyc_2 |
---|
PFAM accession number: | PF09778 |
---|---|
Interpro abstract (IPR018616): | GUCD1 contains a guanylyl cyclase domain and is found highly expressed in liver during regeneration [ (PUBMED:24743017) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Guanylate_cyc_2