The domain within your query sequence starts at position 155 and ends at position 205; the E-value for the Guanylate_kin domain shown below is 3.8e-18.

KRKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEY

Guanylate_kin

• PFAM accession number: PF00625
• Interpro abstract (IPR008145):

  This entry represents a domain found in guanylate kinase ( EC 2.7.4.8 ) and in L-type calcium channel.

  Guanylate kinase ( EC 2.7.4.8 ) (GK) [ (PUBMED:1314905) ] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [ (PUBMED:1310897) (PUBMED:8097461) (PUBMED:1329277) ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus.

  L-type calcium channnels are formed from different alpha-1 subunit isoforms that determine the pharmacological properties of the channel, since they form the drug binding domain. Other properties, such as gating voltage-dependence, G protein modulation and kinase susceptibility, are influenced by alpha-2, delta and beta subunits.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Guanylate_kin