The domain within your query sequence starts at position 167 and ends at position 223; the E-value for the HAD_2 domain shown below is 1e-7.

EYATDTKAMVVGKPEKTFFLEALRDADCAPEEAVMIGDDCRDDVDGAQNIGMLGILV

HAD_2

HAD_2
PFAM accession number:PF13419
Interpro abstract (IPR041492):

The haloacid dehalogenase (HAD) superfamily includes a diverse range of enzymes that use an asp carboxylate as a nucleophile [ (PUBMED:22607316) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAD_2