The domain within your query sequence starts at position 5 and ends at position 128; the E-value for the HAD_2 domain shown below is 8.9e-7.
LVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGLWTEFMGRVFKYLRDEGVKADE LKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAAAFHDVFDHVFTN PASF
HAD_2 |
---|
PFAM accession number: | PF13419 |
---|---|
Interpro abstract (IPR041492): | The haloacid dehalogenase (HAD) superfamily includes a diverse range of enzymes that use an asp carboxylate as a nucleophile [ (PUBMED:22607316) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAD_2