The domain within your query sequence starts at position 331 and ends at position 421; the E-value for the HAGH_C domain shown below is 6.2e-23.
EYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQ EALGPGPGPTSDDGCSRAQLLEELRRLKDMH
HAGH_C |
![]() |
---|
PFAM accession number: | PF16123 |
---|---|
Interpro abstract (IPR032282): | This domain is found at the C terminus of hydroxyacylglutathione hydrolase enzymes. Substrate binding occurs at the interface between this domain and the catalytic domain ( IPR001279 ) [ (PUBMED:10508780) (PUBMED:14529289) (PUBMED:17764159) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAGH_C