The domain within your query sequence starts at position 47 and ends at position 354; the E-value for the HAP1_N domain shown below is 1.3e-129.
LEEQLPQYKLRVDSLFLYENQDWAQSSHQQQDAPETLSPVLAEETFRYMILGTDRVEQMT KTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHVLSEQNEALEEQLGQAFDQVNQLQH ELSKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLDMLHEKLRELEEENMA LRSKACHIKTETFTYEEKEQQLVNDCVKELRETNAQMSRMTEELSGKSDELLRYQEEISS LLSQIVDLQHKLKEHVIEKEELRLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEE IKELRSKS
HAP1_N |
---|
PFAM accession number: | PF04849 |
---|---|
Interpro abstract (IPR006933): | This entry represents a N-terminal conserved region found in huntingtin-associated protein 1 (HAP1), trafficking Kinesin proteins TRAK1 and TRAK2 (vertebrate), Milton (Drosophila) and T27A3.1 (C. elegans) [ (PUBMED:27737633) ]. HAP1 binds to huntingtin in a polyglutamine repeat-length-dependent manner [ (PUBMED:7477378) (PUBMED:9599014) (PUBMED:9285789) ]. It is involved in intracellular trafficking [ (PUBMED:19262167) ]. HAP1 is also linked to Alzheimer's disease. It regulates amyloid precursor protein subcellular trafficking to the non-amyloidogenic pathway and may negatively regulate Abeta production in neurons [ (PUBMED:22731248) ]. TRAK1 binds to both kinesin-1 and dynein/dynactin, is prominently localized in axons, and is needed for normal axon outgrowth, whereas TRAK2 predominantly interacts with dynein/dynactin, is more abundantly present in dendrites, and is required for dendritic development [ (PUBMED:23395375) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAP1_N