The domain within your query sequence starts at position 25 and ends at position 130; the E-value for the HATPase_c domain shown below is 8e-8.
SHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVISDHICLTFTDNGNGMTADKLHKMLSFG FSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAMVFTKNGETMSVGFL
HATPase_c |
![]() |
---|
PFAM accession number: | PF02518 |
---|---|
Interpro abstract (IPR003594): | This domain is found in several ATP-binding proteins, including: histidine kinase [ (PUBMED:15157101) ], DNA gyrase B, topoisomerases [ (PUBMED:15105144) ], heat shock protein HSP90 [ (PUBMED:15292259) (PUBMED:14718169) (PUBMED:15217611) ], phytochrome-like ATPases and DNA mismatch repair proteins. The fold of this domain consists of two layers, alpha/beta, which contains an 8-stranded mixed beta-sheet. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HATPase_c