The domain within your query sequence starts at position 4 and ends at position 67; the E-value for the HAUS2 domain shown below is 1.8e-21.
ANPWDPASSQTAAGLLLNHLVASGIVTKEMLDVSKKMAPCFVNFSRLQQISDIQAEIYQL RNVM
HAUS2 |
![]() |
---|
PFAM accession number: | PF15003 |
---|---|
Interpro abstract (IPR028346): | This entry represents HAUS augmin-like complex subunit 2 from animals (HAUS2) and plants (AUG2) [ (PUBMED:19427217) (PUBMED:22505726) ]. The HAUS (Homologous to AUgmin Subunits) individual subunits have been designated HAUS1 to HAUS8 [ (PUBMED:19427217) ]. In animals, HAUS augmin-like complex subunit 2 is a component of the HAUS augmin-like complex, which localises to the centrosomes and interacts with the gamma-tubulin ring complex (gamma-TuRC) [ (PUBMED:14654843) ]. The interaction between augmin and gamm-TuRC is important for spindle microtubule generation and affects the mitotic progression and cytokinesis [ (PUBMED:19369198) ]. HAUS2 may also increase the tension between spindle and kinetochore allowing for chromosome segregation during mitosis [ (PUBMED:19369198) ]. The HAUS augmin-like complex subunit 2 was previously known as centrosomal protein of 27kDa (Cep27). In plants, the augmin complex contains 8 subunits, including two plant-specific subunits [ (PUBMED:22505726) ]. Despite lacking cetrosomes, the augmin complex in plants plays an important part in gamma-tubulin-dependent MT nucleation and the assembly of microtubule arrays during mitosis [ (PUBMED:22505726) ]. |
GO process: | spindle assembly (GO:0051225), microtubule organizing center organization (GO:0031023) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAUS2