SMART: Pfam domain HAUS6

The domain within your query sequence starts at position 14 and ends at position 238; the E-value for the HAUS6_N domain shown below is 1.1e-77.

LWMYLQALGLDPSSSITFGGKMVPHAHLGENMFDKLNRDAFHIVSYFLFKTLDEALAKEV
FRDCWPPFDQKLDMEFRKHCCEWLKEISAECGSSFPQVVGSLLMSPGGPKFIHLMYHFAR
YVAIKYIKTKSNNSLHFAETFNVKPQDMHKCLARSHVARNRFLQILQREHYVMQKYQENV
NLSVKQVRNARSECMSLQNQIKRMEPYDEKSNTQEKIQKVRSLWA

HAUS6_N

PFAM accession number:	PF14661
Interpro abstract (IPR028163):	This entry represents the N-terminal domain of the subunit 6 of the HAUS augmin-like complex, involved in mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis [ (PUBMED:19369198) (PUBMED:19427217) ]. Subunit 6 interacts with the NEDD1-gamma-tubulin complex and recruits this complex to the spindle, which in turn promotes microtubule polymerisation [ (PUBMED:19029337) ].

PFAM accession number:

PF14661

Interpro abstract (IPR028163):

This entry represents the N-terminal domain of the subunit 6 of the HAUS augmin-like complex, involved in mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis [ (PUBMED:19369198) (PUBMED:19427217) ]. Subunit 6 interacts with the NEDD1-gamma-tubulin complex and recruits this complex to the spindle, which in turn promotes microtubule polymerisation [ (PUBMED:19029337) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAUS6_N