The domain within your query sequence starts at position 1 and ends at position 177; the E-value for the HDNR domain shown below is 1.2e-66.
MAKGRRFNPSLNNDGRWFTHTGLTEKTPESITCTSLKETHCPYLSEQVERRLPPIYKIRE KQAANKNFPFSVHDNRHSFQNSGYYFDSGLGRKKFTPDQKQHISRNFNLWACDYIPSNFD GLSNNQTSYVPKKAVVISTFRRFPRYYDEKWSDYKFAYNQNCAKFLGYQPNGELAVD
HDNR |
![]() |
---|
PFAM accession number: | PF15115 |
---|---|
Interpro abstract (IPR029369): | This domain is found in a group of eukaryotic proteins that are typically between 117 and 219 amino acids in length. There is a conserved HDNR sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HDNR