SMART: Pfam domain HEAT

The domain within your query sequence starts at position 13 and ends at position 43; the E-value for the HEAT domain shown below is 2.1e-5.

IIPMFSNLASDEQDSVRLLAVEACVNIAQLL

HEAT

PFAM accession number:	PF02985
Interpro abstract (IPR000357):	The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [ (PUBMED:7550332) ]. Arrays of HEAT repeats consists of 3 to 36 units forming a rod-like helical structure and appear to function as protein-protein interaction surfaces. It has been noted that many HEAT repeat-containing proteins are involved in intracellular transport processes. In the crystal structure of PP2A PR65/A [ (PUBMED:9989501) ], the HEAT repeats consist of pairs of antiparallel alpha helices [ (PUBMED:7550332) ].
GO function:	protein binding (GO:0005515)

PFAM accession number:

PF02985

Interpro abstract (IPR000357):

The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [ (PUBMED:7550332) ]. Arrays of HEAT repeats consists of 3 to 36 units forming a rod-like helical structure and appear to function as protein-protein interaction surfaces. It has been noted that many HEAT repeat-containing proteins are involved in intracellular transport processes.

In the crystal structure of PP2A PR65/A [ (PUBMED:9989501) ], the HEAT repeats consist of pairs of antiparallel alpha helices [ (PUBMED:7550332) ].

GO function:

protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HEAT