SMART: Pfam domain HGTP

The domain within your query sequence starts at position 1280 and ends at position 1535; the E-value for the HGTP_anticodon2 domain shown below is 1e-16.

TVSSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQEYCRHHEITYVA
LVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVMQKLRTKVGDERNFRDASDNLAVQTL
KGSFSNASGLFEIHGTTVVPNVIVLAPEKLSASTRRRHEIQVQTRLQTTLANLHQKSSEI
EILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKV
SVLFLYSYRDDYYRIL

HGTP_anticodon2

PFAM accession number:	PF12745
Interpro abstract (IPR024435):	This entry represents the histidyl-tRNA synthetase-related (HisRS-related) domain, found largely in Gcn2 protein kinases [ (PUBMED:1739968) ]. In yeast, Gcn2 phosphorylates the alpha subunit of eukaryotic initiation factor-2 (eIF-2) when the cells face the starvation for amino acids. The HisRS-related domain is required for activation of Gcn2 kinase function [ (PUBMED:8798780) (PUBMED:10655230) ].

PFAM accession number:

PF12745

Interpro abstract (IPR024435):

This entry represents the histidyl-tRNA synthetase-related (HisRS-related) domain, found largely in Gcn2 protein kinases [ (PUBMED:1739968) ]. In yeast, Gcn2 phosphorylates the alpha subunit of eukaryotic initiation factor-2 (eIF-2) when the cells face the starvation for amino acids. The HisRS-related domain is required for activation of Gcn2 kinase function [ (PUBMED:8798780) (PUBMED:10655230) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HGTP_anticodon2