The domain within your query sequence starts at position 162 and ends at position 219; the E-value for the HHH_2 domain shown below is 2.3e-13.
TVQQIPGVGKVKAPLLLQKFPSIQQLSNASVQELEEVVGPAAAQQIHTFFTQPKRQQP
HHH_2 |
---|
PFAM accession number: | PF12826 |
---|---|
Interpro abstract (IPR041663): | This HhH domain is a DNA-binding domain [ (PUBMED:18439896) ]. It can be found in bacterial checkpoint control protein DisA, NAD-dependent DNA ligase LigA, UvrABC system protein C [ (PUBMED:12034838) ] and in the ATP-dependent DNA helicase Hel308 (also known as HelQ) [ (PUBMED:28101207) ]. DNA integrity scanning protein (DisA) participates in a DNA-damage check-point that is active prior to asymmetric division when DNA is damaged. DisA forms globular foci that rapidly scan along the chromosomes during sporulation, searching for lesions. When a lesion is present, disA pauses at the lesion site. This triggers a cellular response that culminates in a temporary block in sporulation initiation [ (PUBMED:9141693) (PUBMED:16713562) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HHH_2