The domain within your query sequence starts at position 24 and ends at position 84; the E-value for the HIT domain shown below is 4.7e-17.
RKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVADDDDESVSKFLTLHFLF V
HIT |
---|
PFAM accession number: | PF01230 |
---|---|
Interpro abstract (IPR001310): | The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [ (PUBMED:1472710) ]. Crystal structure of rabbit Hint, purified as an adenosine and AMP-binding protein, showed that proteins in the HIT superfamily are conserved as nucleotide-binding proteins and that Hint homologues, which are found in all forms of life, are structurally related to Fhit homologues and GalT-related enzymes, which have more restricted phylogenetic profiles [ (PUBMED:9164465) ]. Hint homologues including rabbit Hint and yeast Hnt1 hydrolyse adenosine 5' monophosphoramide substrates such as AMP-NH2 and AMP-lysine to AMP plus the amine product and function as positive regulators of Cdk7/Kin28 in vivo [ (PUBMED:11805111) ]. Fhit homologues are diadenosine polyphosphate hydrolases [ (PUBMED:8794732) ] and function as tumour suppressors in human and mouse [ (PUBMED:10758156) ] though the tumour suppressing function of Fhit does not depend on ApppA hydrolysis [ (PUBMED:9576908) ]. The third branch of the HIT superfamily, which includes GalT homologues, contains a related His-X-His-X-Gln motif and transfers nucleoside monophosphate moieties to phosphorylated second substrates rather than hydrolysing them [ (PUBMED:12119013) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HIT