The domain within your query sequence starts at position 540 and ends at position 627; the E-value for the HNF-1A_C domain shown below is 3.4e-38.
VFTSDTEASSEPGLHEPPSPATTIHIPSQDPSNIQHLQPAHRLSTSPTVSSSSLVLYQSS DSNGHSHLLPSNHSVIETFISTQMASSS
HNF-1A_C |
 |
|---|
| PFAM accession number: | PF04813 |
|---|---|
| Interpro abstract (IPR006898): | This domain consists of an alternative C terminus of homeobox-containing transcription factor HNF-1, found in the HNF-1A isoform. Different isoforms of HNF-1 are generated by the differential use of polyadenylation sites and by alternative splicing. The C-terminal region of HNF-1 is responsible for the activation of transcription, and HNF-1A, which has this C-terminal extension, transactivates less well than the B and C isoforms [ (PUBMED:7900999) ]. Mutations and polymorphisms in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3) [ (PUBMED:9133564) ]. |
| GO process: | positive regulation of transcription, DNA-templated (GO:0045893) |
| GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNF-1A_C