The domain within your query sequence starts at position 517 and ends at position 870; the E-value for the HPS3_C domain shown below is 9.2e-199.
MKNIDPLTALHYLRKLDSCGVSPVLVTLTKAAVALKMGDLDMYRNEMKSHSEMKLVYGFI LEPRLLIQQWKGQIVPTELAIDLKETQPGLLVASVLGLQKNDKIGIVETDSFFKVLCGKD EDAVPQLLIDFWEAQLVACLPNVVLEELFFKLISQYVWRLSERRCPDTVPLRTAEDLINA CSHYGLVNPWVHVLTTSDSLADKNYTDDLLKLQSLICSPSLDVASIIPFLEPLSEDTVAG LSTHALCHTRLQEYEQCIDTLLERCPEAVIAYANQELKEDHWILWWKKLLPELCQRVKSG GERSHLHLSLLKETLSVIAVGLDLRDFLNVLPEDGAAAFFLPYLLFCSRKKSLT
HPS3_C |
---|
PFAM accession number: | PF14763 |
---|---|
Interpro abstract (IPR029438): | This entry represents the C-terminal domain of the Hermansky-Pudlak syndrome 3 (HPS3) protein. In human HPS3, this region carries a number of tyrosine sorting motifs and the second of two di-leucine sorting boxes at residues 711-717, as well as the ER membrane-retention signal KKPL at residues 1000-1003. Hermansky-Pudlak syndrome caused by mutations in HPS3 gene is a genetically heterogeneous autosomal recessive disorder characterised by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects [ (PUBMED:11455388) (PUBMED:11590544) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HPS3_C