The domain within your query sequence starts at position 1 and ends at position 47; the E-value for the HSF_DNA-bind domain shown below is 8.8e-9.

MYGFRKVFALQTEKTSQENKISIEFQHPLFKRGEACLLANIKRKVPT

HSF_DNA-bind

HSF_DNA-bind
PFAM accession number:PF00447
Interpro abstract (IPR000232):

Heat shock factor (HSF) is a transcriptional activator of heat shock genes [ (PUBMED:2257625) (PUBMED:19864465) ]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [ (PUBMED:2257625) ]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [ (PUBMED:1871105) ]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [ (PUBMED:1871106) ]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [ (PUBMED:1871105) ]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [ (PUBMED:1871106) ]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:sequence-specific DNA binding (GO:0043565), DNA-binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSF_DNA-bind