The domain within your query sequence starts at position 1 and ends at position 91; the E-value for the HSNSD domain shown below is 1.7e-62.
MGYAVSPHHSGVYPVHVQLYEAWKKVWNIKITSTEEYPHLKPARYRRGFIHKNIMVLPRQ TCGLFTHTIFYKEYPGGPRELDKSIHGGELF
HSNSD |
![]() |
---|
PFAM accession number: | PF12062 |
---|---|
Interpro abstract (IPR021930): | This domain is found in heparan sulphate N-deacetylase enzymes. It is often found associated with . |
GO function: | hydrolase activity (GO:0016787), [heparan sulfate]-glucosamine N-sulfotransferase activity (GO:0015016) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSNSD