The domain within your query sequence starts at position 1222 and ends at position 1318; the E-value for the HTH_40 domain shown below is 2.7e-9.
QSVAVTYTLFQEKKMPLHSIAENRLLPLTAAGMHLAQAVKAGYPLDMERAGLTPETWKII MDVIRNPPINSDMYKVKLIRMLVPENLDTYLIHMAIE
HTH_40 |
 |
|---|
| PFAM accession number: | PF14493 |
|---|---|
| Interpro abstract (IPR029491): | This presumed domain is found at the C terminus of a large number of helicases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HTH_40