The domain within your query sequence starts at position 211 and ends at position 299; the E-value for the HYLS1_C domain shown below is 6.4e-43.
ILPRLDQLSRNRGKIDRVARYFEYKRDWDSMRFPGEDHRKELRWSVRGQMLSRTEPPSKP QHVYVPNNYLVPTEKKRSALRWGVRCDLA
HYLS1_C |
---|
PFAM accession number: | PF15311 |
---|---|
Interpro abstract (IPR027918): | This entry represents the C-terminal domain of hydrolethalus syndrome protein 1 (HYLS1). The HYLS1 gene shows alternative splicing and the transcript is found in multiple tissues during foetal development [ (PUBMED:15843405) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HYLS1_C