The domain within your query sequence starts at position 10 and ends at position 188; the E-value for the Ham1p_like domain shown below is 4.3e-54.

IVFVTGNAKKLEEVIQILGDNFPCTLEAQKIDLPEYQGEPDEISIQKCREAARQVQGPVL
VEDTCLCFNALGGLPGPYIKWFLQKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPV
LLFRGQTSGQIVMPRGSRDFGWDPCFQPDGYEQTYAEMPKSEKNTISHRFRALHKLQEY

Ham1p_like

• PFAM accession number: PF01725
• Interpro abstract (IPR002637):

  This family contains the Saccharomyces cerevisiae (Baker's yeast) HAM1 protein P47119 and other hypothetical archaeal, bacterial and Caenorhabditis elegans proteins. S. cerevisiae HAM1 was originally identified as a gene that protects against the mutagenic effects of the base analogue 6-N-hydroxylaminopurine (HAP) which can be a natural product of monooxygenase activity on adenine [ (PUBMED:8789257) (PUBMED:9918490) ]. Subsequent studies demonstrated that HAM1 detoxifies abnormal pyrimidine as well as purine nucleotides [ (PUBMED:17899088) ].

  Similarly, a Ham1-related protein from Methanococcus jannaschii is a novel NTPase that has been shown to hydrolyze nonstandard nucleotides such as XTP to XMP and ITP to IMP, but not the standard nucleotides, in the presence of Mg or Mn ions. The enzyme exists as a homodimer [ (PUBMED:10404228) ].

• GO process: nucleoside triphosphate catabolic process (GO:0009143)
• GO function: nucleoside-triphosphate diphosphatase activity (GO:0047429)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ham1p_like