The domain within your query sequence starts at position 335 and ends at position 535; the E-value for the Headcase domain shown below is 2.8e-86.
AGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHR NVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVPCHLQGRLMHLYAVCVDCLEG VHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSE YSNVQQCPHCGNLDYHFVKPF
Headcase |
---|
PFAM accession number: | PF16002 |
---|---|
Interpro abstract (IPR031947): | This domain is found in Drosophila headcase protein [ (PUBMED:8575315) ] and the human headcase protein homologue. Drosophila headcase protein is involved in dendrite pruning [ (PUBMED:23197702) ] and is a branching inhibitor during tracheal development [ (PUBMED:11463742) ]. It also promotes cell survival and niche maintenance in the Drosophila testis [ (PUBMED:23874487) ]. Human headcase protein may play an important role in human carcinogenesis [ (PUBMED:11696983) (PUBMED:19643820) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Headcase