The domain within your query sequence starts at position 19 and ends at position 132; the E-value for the Hemerythrin domain shown below is 4.4e-11.
SVVELSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNK LSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPML
Hemerythrin |
---|
PFAM accession number: | PF01814 |
---|---|
Interpro abstract (IPR012312): | This entry represents a haemerythrin cation-binding domain that occurs [ (PUBMED:12625841) ] in haemerythrins, myohemerythrins and related proteins. This domain binds iron in haemerythrin, but can bind other metals in related proteins, such as cadmium in a Nereis diversicolor protein ( P80255 ) [ (PUBMED:12743530) ]. This domain is also found in Repair of iron centres or Ric proteins [ (PUBMED:19140014) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hemerythrin