The domain within your query sequence starts at position 101 and ends at position 197; the E-value for the Hep_59 domain shown below is 3e-34.
SFSAETNRRDEDADMMKYIETELKKRKGIVEQEEQKAKPKNAEDCLYELPENIRVSSAKK TEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARL
Hep_59 |
 |
|---|
| PFAM accession number: | PF07052 |
|---|---|
| Interpro abstract (IPR010756): | Tls1 in fission yeast is required for telomeric heterochromatin assembly as well as telomere length control [ (PUBMED:25245948) ]. The human homologue, also known as hepatocellular carcinoma-associated antigen 59 or C9ORF78, is associated with the spliceosome and is overexpressed in multiple cancer cell lines [ (PUBMED:12097419) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hep_59