The domain within your query sequence starts at position 761 and ends at position 960; the E-value for the Hira domain shown below is 2.9e-61.
CGRRLLPPILLPSPISTLHCTGPYVMALTAAATLSVWDVHRQVVVVKEESLHSILSGSDM TVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRNSLPSQDAMLC SGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLLY ARYLVNEGFEYRLREICKDL
Hira |
![]() |
---|
PFAM accession number: | PF07569 |
---|---|
Interpro abstract (IPR011494): | The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin. These proteins also contain IPR001680 . |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hira