The domain within your query sequence starts at position 70 and ends at position 297; the E-value for the HlyIII domain shown below is 1.2e-53.

FQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSITYLTCSLLA
HLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWIFFLPAAAFCGWL
SCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHLAGCQEQAAWYHT
LQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQL

HlyIII

HlyIII
PFAM accession number:PF03006
Interpro abstract (IPR004254):

Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus [ (PUBMED:7495855) ]. YOL002c (AdipoR-like receptor IZH2) from Saccharomyces cerevisiae encodes a protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism [ (PUBMED:11916977) (PUBMED:15664187) ]. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adiponectin (AdipoQ) receptors (AdipoR), and hence have been named PAQR proteins [ (PUBMED:16044242) ]. The mammalian members include progesterone binding proteins [ (PUBMED:17082257) ]. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HlyIII