The domain within your query sequence starts at position 245 and ends at position 282; the E-value for the HnRNPA1 domain shown below is 9.5e-19.
SGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGG
HnRNPA1 |
---|
PFAM accession number: | PF11627 |
---|---|
Interpro abstract (IPR021662): | This family of proteins represents hnRNPA1, a nuclear factor that binds to Pol II transcripts. The family of hnRNP proteins are involved in numerous RNA-related activities [ (PUBMED:15776420) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HnRNPA1