The domain within your query sequence starts at position 266 and ends at position 303; the E-value for the HnRNPA1 domain shown below is 8.4e-18.

GGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGG

HnRNPA1

 HnRNPA1
PFAM accession number:PF11627
Interpro abstract (IPR021662):

This family of proteins represents hnRNPA1, a nuclear factor that binds to Pol II transcripts. The family of hnRNP proteins are involved in numerous RNA-related activities [ (PUBMED:15776420) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HnRNPA1