The domain within your query sequence starts at position 163 and ends at position 257; the E-value for the ICMT domain shown below is 3.7e-37.
GLLMVVFGECLRKAAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIG TQVMLCNPICGVVYALTVWRFFRDRTEEEEISLIH
ICMT |
---|
PFAM accession number: | PF04140 |
---|---|
Interpro abstract (IPR007269): | The isoprenylcysteine o-methyltransferase ( EC 2.1.1.100 ) carries out carboyxl methylation of cleaved eukaryotic proteins that terminate in a CaaX motif. In Saccharomyces cerevisiae, this methylation is carried out by Ste14p, an integral endoplasmic reticulum membrane protein. Ste14p is the founding member of the isoprenylcysteine carboxyl methyltransferase (ICMT) family, whose members share significant sequence homology [ (PUBMED:11451995) ]. This entry also includes ICMT from Methanosarcina acetivorans ( Q8TMG0 ). It comprises a core of five transmembrane alpha helices and a cofactor-binding pocket enclosed within a highly conserved C-terminal catalytic subdomain [ (PUBMED:22195972) ]. |
GO process: | C-terminal protein methylation (GO:0006481) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity (GO:0004671) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ICMT