The domain within your query sequence starts at position 8 and ends at position 80; the E-value for the IFP_35_N domain shown below is 9.1e-21.

VLYSLQEEQARLKMRLQELQQLKRERTGSPGAKIPFSVPEVPLVFQGQTKQGRQVPKFVV
SNLKVCCPLPEGS

IFP_35_N

IFP_35_N
PFAM accession number:PF07334
Interpro abstract (IPR009938):

This entry represents the N terminus of interferon-induced 35kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [ (PUBMED:10950963) ]. This group of proteins also includes N-myc-interactor (Nmi), a homologous interferon-induced protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFP_35_N