The domain within your query sequence starts at position 8 and ends at position 80; the E-value for the IFP_35_N domain shown below is 9.1e-21.
VLYSLQEEQARLKMRLQELQQLKRERTGSPGAKIPFSVPEVPLVFQGQTKQGRQVPKFVV SNLKVCCPLPEGS
IFP_35_N |
---|
PFAM accession number: | PF07334 |
---|---|
Interpro abstract (IPR009938): | This entry represents the N terminus of interferon-induced 35kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [ (PUBMED:10950963) ]. This group of proteins also includes N-myc-interactor (Nmi), a homologous interferon-induced protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFP_35_N