The domain within your query sequence starts at position 1 and ends at position 87; the E-value for the IFRD domain shown below is 1.1e-29.
MSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGLKNAL SSKVLYEFVLERRMTLTDSIERCLKK
IFRD |
---|
PFAM accession number: | PF05004 |
---|---|
Interpro abstract (IPR007701): | Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [ (PUBMED:9050919) ]. IFRD1 is a transcriptional coactivator/repressor controlling patterns of gene expression by interacting with transcription factors or histone deacetylase (HDAC) complexes [ (PUBMED:26391411) ]. This entry also contains IFRD2 and its murine equivalent SKMc15, which are highly expressed soon after gastrulation and in the hepatic primordium, suggesting an involvement in early hematopoiesis [ (PUBMED:9722946) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFRD