The domain within your query sequence starts at position 385 and ends at position 438; the E-value for the IFRD_C domain shown below is 1.1e-25.

NELLRDIFGLGPVLVLDAAALKACKISRFEKHLYNAAAFKARTKARSRARDKRA

IFRD_C

 IFRD_C
PFAM accession number:PF04836
Interpro abstract (IPR006921):

This domain, primarily C-terminal, is found in a family of proteins thought to be involved in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF [ (PUBMED:9722946) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFRD_C