The domain within your query sequence starts at position 59 and ends at position 113; the E-value for the IFT46_B_C domain shown below is 1.1e-26.

GAYDPADYEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAF

IFT46_B_C

IFT46_B_C
PFAM accession number:PF12317
Interpro abstract (IPR022088):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 298 and 416 amino acids in length. IFT46 is a flagellar protein of complex B. Like all IFT (Intraflagellar transport) proteins, it is required for transport of IFT particles into the flagella [ (PUBMED:17312020) ].

GO process:intraciliary transport (GO:0042073)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFT46_B_C