The domain within your query sequence starts at position 59 and ends at position 272; the E-value for the IFT46_B_C domain shown below is 1.1e-105.
GAYDPADYEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPR PDGKPDHLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDT WIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTVEIDCSLAEYID MICAILDIPFYKSRIQSLHLLFSLYSEFKNSQHF
IFT46_B_C |
![]() |
---|
PFAM accession number: | PF12317 |
---|---|
Interpro abstract (IPR022088): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 298 and 416 amino acids in length. IFT46 is a flagellar protein of complex B. Like all IFT (Intraflagellar transport) proteins, it is required for transport of IFT particles into the flagella [ (PUBMED:17312020) ]. |
GO process: | intraciliary transport (GO:0042073) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFT46_B_C