The domain within your query sequence starts at position 1 and ends at position 120; the E-value for the IIGP domain shown below is 1.6e-22.
MLKQKIWKESIMPRAWATIPSRGLTQKDMEMLQQTLNDYRSSFGLDEASLENIAEDLNVT LEELKANIKSPHLLSDEPDTSLTEKLLKYIGNPYFSKVFHLQNYFIDTVASDVKIILSKE
IIGP |
---|
PFAM accession number: | PF05049 |
---|---|
Interpro abstract (IPR007743): | This entry represents a group of immunity-related GTPases like proteins, including interferon-inducible GTPase from mammals. This entry also includes some uncharacterised proteins from bacteria, fungi and invertebrates. Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing [ (PUBMED:11907101) ]. |
GO component: | membrane (GO:0016020) |
GO function: | GTP binding (GO:0005525) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IIGP