The domain within your query sequence starts at position 33 and ends at position 160; the E-value for the IL15 domain shown below is 8.6e-53.

VFILGCVSVGLPKTEANWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFL
LELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFI
RIVQMFIN

IL15

 IL15
PFAM accession number:PF02372
Interpro abstract (IPR003443):

Interleukins (IL) are a group of cytokines that play an important role in the immune system. They modulate inflammation and immunity by regulating growth, mobility and differentiation of lymphoid and other cells.

Interleukin-15 (IL-15) has a variety of biological functions, including stimulation and maintenance of cellular immune responses [ (PUBMED:10689297) ]. It is required for division of CD8+ T cells of memory phenotype, a process that is increased by inhibition of IL-2 [ (PUBMED:10784451) ]. The numbers of CD8+ memory T cells in animals may, therefore, be controlled by a balance between IL-15 and -2.

This entry represents the interleukin-15 and interleukin-21 family.

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:cytokine receptor binding (GO:0005126)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL15