The domain within your query sequence starts at position 75 and ends at position 153; the E-value for the IL17 domain shown below is 3.8e-32.
RSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQG CSNSFRLEKMLLKVGCTCV
IL17 |
---|
PFAM accession number: | PF06083 |
---|---|
Interpro abstract (IPR010345): | Interleukins (IL) are a group of cytokines that play an important role in the immune system. They modulate inflammation and immunity by regulating growth, mobility and differentiation of lymphoid and other cells. Interleukin-17 (IL-17) is a potent proinflammatory cytokine produced by activated memory T cells [ (PUBMED:11781375) ]. The IL-17 family (of which there are 6 known members, termed IL-17A to IL-17F) is thought to represent a distinct signalling system that appears to have been highly conserved across vertebrate evolution [ (PUBMED:11781375) ]. Family members play an active role in inflammatory diseases, autoimmune diseases and cancer [ (PUBMED:15485625) ]. This entry represents interleukin-17 family IL-17A to IL-17F. Interleukin-17E has been renamed as interleukin-25 (IL-25). The orthologue from the nematode Caenorhabditis elegans, known as interleukin cytokine-related protein 17.1, is a neuromodulator of sensory responses, and the ligand for the receptor complex composed of ilcr-1 and ilcr-2 [ (PUBMED:28099418) ]. |
GO component: | extracellular region (GO:0005576) |
GO function: | cytokine activity (GO:0005125) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL17