The domain within your query sequence starts at position 48 and ends at position 169; the E-value for the IL17R_D_N domain shown below is 2.7e-68.
SRNSGLHNITFRYDNCTTYLNPGGKHAIADAQNITISQYACHDQVAVTILWSPGALGIEF LKGFRVILEELKSEGRQCQQLILKDPKQLNSSFRRTGMESQPFLNMKFETDYFVKIVPFP SI
IL17R_D_N |
---|
PFAM accession number: | PF16742 |
---|---|
Interpro abstract (IPR031951): | This entry represents the N-terminal domain of interleukin-17 receptor D (IL17RD) [ (PUBMED:12807873) ]. The function of this domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL17R_D_N