The domain within your query sequence starts at position 28 and ends at position 158; the E-value for the IL31 domain shown below is 7.5e-54.
SFGAPISKEDLRTTIDLLKQESQDLYNNYSIKQASGMSADESIQLPCFSLDREALTNISV IIAHLEKVKVLSENTVDTSWVIRWLTNISCFNPLNLNISVPGNTDESYDCKVFVLTVLKQ FSNCMAELQAK
IL31 |
![]() |
---|
PFAM accession number: | PF15209 |
---|---|
Interpro abstract (IPR027987): | This entry represents interleukin 31 (IL-31), it is a four-helix bundle cytokine that is preferentially produced by T helper type 2 cells [ (PUBMED:15184896) (PUBMED:17030248) ]. It is associated with pruritus, a characteristic feature of atopic dermatitis [ (PUBMED:22621183) ], and with other types of allergic contact dermatitis-provoked skin inflammation [ (PUBMED:17030248) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL31