The domain within your query sequence starts at position 109 and ends at position 210; the E-value for the IL6Ra-bind domain shown below is 6.8e-19.

PPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQL
KSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKM

IL6Ra-bind

IL6Ra-bind
PFAM accession number:PF09240
Interpro abstract (IPR015321):

The alpha chain of the interleukin-6 receptor (IL-6R-alpha) consists of a signal peptide, an extracellular region, a transmembrane domain, and a short cytoplasmic domain. The extracellular region is highly modular, consisting of three domains (D1, D2, and D3). The N-terminal domain D1 is characteristic of the Ig superfamily, and domains D2 and D3 are homologous to cytokine-binding domains (CBD) consisting of two fibronectin type III (FnIII) domains [ (PUBMED:2169613) (PUBMED:12461182) ].

This domain corresponds to the D2 domain in IL-6R-alpha and is also found in other members of the type I cytokine receptor family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL6Ra-bind