The domain within your query sequence starts at position 28 and ends at position 84; the E-value for the IMPDH domain shown below is 3.9e-20.

DGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMAL

IMPDH

 IMPDH
PFAM accession number:PF00478
Interpro abstract (IPR001093):

Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase

This entry contains two related enzymes: IMP dehydrogenase and GMP reductase. These enzymes adopt a TIM barrel structure.

IMP dehydrogenase ( EC 1.1.1.205 ) (IMPDH) catalyses the rate-limiting reaction of de novo GTP biosynthesis, the NAD-dependent reduction of IMP into XMP [ (PUBMED:2902093) ]. Inosine 5-phosphate + NAD + + H 2 O = xanthosine 5-phosphate + NADH IMP dehydrogenase is associated with cell proliferation and is a possible target for cancer chemotherapy. Mammalian and bacterial IMPDHs are tetramers of identical chains. There are two IMP dehydrogenase isozymes in humans [ (PUBMED:1969416) ]. IMP dehydrogenase nearly always contains a long insertion that has two CBS domains within it.

GMP reductase ( EC 1.7.1.7 ) catalyses the irreversible and NADPH-dependent reductive deamination of GMP into IMP [ (PUBMED:2904262) ]. NADPH + guanosine 5-phosphate = NADP + + inosine 5-phosphate + NH 3 It converts nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and maintains intracellular balance of A and G nucleotides.

GO process:oxidation-reduction process (GO:0055114)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IMPDH